DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl7 and fbxl4

DIOPT Version :9

Sequence 1:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster
Sequence 2:XP_031761765.1 Gene:fbxl4 / 100490265 XenbaseID:XB-GENE-961513 Length:622 Species:Xenopus tropicalis


Alignment Length:370 Identity:107/370 - (28%)
Similarity:159/370 - (42%) Gaps:55/370 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 SAIGPPPWNRKGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISL 446
            |..|...|...|      .||:||.|.:..|.|.|...:||.:|:.|:........|:.:..:||
 Frog   268 SNTGIREWTNNG------YFDKLPYELIQFIISHLALPDLCRLAQTCKLMYQHCCDPLQYTHLSL 326

  Fly   447 RGEHLN-GDKTLKMIFRQLCGQSCNGACPEVERVMLA-DGCR--ISDKGLQLLTRRC-PELTHLQ 506
            :....| .|.:|:.:..:         |..|:.:.|: .|.|  ||..|...|.:.| .||..|:
 Frog   327 QPYWTNVNDNSLEYLLPR---------CSLVQWLNLSWTGNRGLISTSGFSRLLKVCGSELVRLE 382

  Fly   507 LQTCVDITNQALVEALTK-CSNLQHLDVTGCSQVSSISPNPHMEPP------------RRLLLQY 558
            | .|....|:|.:|.:.: |.|||.|:::.|.::          ||            :||:|..
 Frog   383 L-ACGHFLNEACLEVIAEMCPNLQELNLSSCDKL----------PPQAFSHICKLSGLKRLVLYR 436

  Fly   559 LDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGL--KFVPSFCVSLKELSVSDCLNITD 621
                  ..|:...|..::..||::.:|.|..|:.:.|..|  ..:.:.|..|:.|.:..|.|||:
 Frog   437 ------TKIEQTALLSILNFCPEIQHLNLGSCVLIEDYDLVASVLGAKCKKLRSLDLWRCKNITE 495

  Fly   622 FGLYELAKLGAALRYLSVAKCERV-SDAGLKV-IARRCYKLRYLNARGCEAVSDDSITVLARSCP 684
            .|:.|||.....|..|.:..|..: |..|..| :|.:...||.|......:|.|..|..|||:|.
 Frog   496 RGIAELASGCLLLEELDLGWCPTLQSSTGCFVNLASKLPNLRKLFLTANRSVCDSDIEELARNCQ 560

  Fly   685 RLRALDI-GKCDVSDAGLRALAESCPNLKKLSLRSCDMITDRGVQ 728
            .|:.||| |...||.|.|..|.|.|..|..|.:..|..|..|.||
 Frog   561 HLQQLDILGTRMVSPAALCKLLECCKELFLLDVSFCSQIDSRVVQ 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 14/45 (31%)
leucine-rich repeat 441..460 CDD:275381 5/19 (26%)
AMN1 <451..595 CDD:187754 39/161 (24%)
leucine-rich repeat 476..501 CDD:275381 9/28 (32%)
leucine-rich repeat 502..521 CDD:275381 6/18 (33%)
leucine-rich repeat 528..555 CDD:275381 7/38 (18%)
leucine-rich repeat 556..581 CDD:275381 4/24 (17%)
AMN1 577..746 CDD:187754 54/157 (34%)
leucine-rich repeat 582..607 CDD:275381 6/26 (23%)
leucine-rich repeat 608..633 CDD:275381 10/24 (42%)
leucine-rich repeat 634..659 CDD:275381 7/26 (27%)
leucine-rich repeat 660..685 CDD:275381 10/24 (42%)
leucine-rich repeat 686..710 CDD:275381 12/24 (50%)
leucine-rich repeat 711..735 CDD:275381 7/18 (39%)
leucine-rich repeat 737..761 CDD:275381
fbxl4XP_031761765.1 F-box-like 281..325 CDD:403981 13/43 (30%)
leucine-rich repeat 296..318 CDD:275381 5/21 (24%)
leucine-rich repeat 319..341 CDD:275381 5/21 (24%)
leucine-rich repeat 348..377 CDD:275381 9/28 (32%)
leucine-rich repeat 378..403 CDD:275381 8/25 (32%)
leucine-rich repeat 404..428 CDD:275381 6/33 (18%)
AMN1 427..606 CDD:187754 59/185 (32%)
leucine-rich repeat 429..453 CDD:275381 6/29 (21%)
leucine-rich repeat 454..481 CDD:275381 6/26 (23%)
leucine-rich repeat 482..507 CDD:275381 10/24 (42%)
leucine-rich repeat 508..535 CDD:275381 7/26 (27%)
leucine-rich repeat 536..561 CDD:275381 10/24 (42%)
leucine-rich repeat 562..587 CDD:275381 12/24 (50%)
leucine-rich repeat 588..613 CDD:275381 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.