DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and WFDC8

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:XP_016883608.1 Gene:WFDC8 / 90199 HGNCID:16163 Length:247 Species:Homo sapiens


Alignment Length:52 Identity:14/52 - (26%)
Similarity:23/52 - (44%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICL 77
            |:.|:..|......:.|.::..:.||..|.:.|...|.|||..:..|...|:
Human    95 CMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTACM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 13/49 (27%)
WFDC8XP_016883608.1 WAP 47..90 CDD:459672
KU 93..145 CDD:197529 13/49 (27%)
WAP 150..190 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.