DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and spint1b

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001104693.2 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:501 Species:Danio rerio


Alignment Length:71 Identity:27/71 - (38%)
Similarity:39/71 - (54%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SCLLILLVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQA 70
            |..:|:||...:||   :|.||.|...|..:|....|.||:.|:||::|||.|...|.||:.::.
Zfish   220 SAQVIVLVLTSEQS---ERHCLTPKKTGPCRASFIRWNYNAASRRCEQFIFGGCMENSNNYLSET 281

  Fly    71 RCHKIC 76
            .|...|
Zfish   282 ECQNAC 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 19/49 (39%)
spint1bNP_001104693.2 None

Return to query results.
Submit another query.