DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and spint2

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 / 733874 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis


Alignment Length:60 Identity:18/60 - (30%)
Similarity:27/60 - (45%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLAQV 80
            |....|..|...|..:|..|.|:|:.|:..|..|.:.|...|.||:.:...|.|.|..::
 Frog   263 SFSEYCAAPSLTGPCRASFRRWYYDVTTATCVAFTYGGCRGNKNNYLSVEDCVKNCAGRL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 16/49 (33%)
spint2NP_001039077.1 MANEC 19..104 CDD:471454
Kunitz-type 117..169 CDD:444694
Kunitz-type 195..246 CDD:444694
Kunitz-type 266..318 CDD:444694 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.