DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and TFPI

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_006278.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens


Alignment Length:51 Identity:19/51 - (37%)
Similarity:28/51 - (54%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |....|.|..:.|:..:|||:.:::|:||.:.|...|.|||.|...|..||
Human   125 CFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNIC 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/49 (35%)
TFPINP_006278.1 Kunitz_TFPI1_1-like 51..105 CDD:438656
Kunitz_TFPI1_2-like 121..176 CDD:438657 19/51 (37%)
Kunitz_TFPI1_TFPI2_3-like 214..267 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.