DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and spint2

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:60 Identity:19/60 - (31%)
Similarity:35/60 - (58%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            :.::|.:.:|:.|.|.|..:|..|.:|:.::||.||.||:.|...|.|.:.::..|..:|
Zfish   295 KSAHSFEEKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRYGSEEECMSVC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/49 (35%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633
Kunitz-type 228..276 CDD:438633
Kunitz-type 302..354 CDD:444694 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.