DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and CG14298

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster


Alignment Length:35 Identity:10/35 - (28%)
Similarity:16/35 - (45%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |:::...  |:.|.:.|...|.|.|.:|..|...|
  Fly    77 WYFDKGV--CKPFNYKGCNGNRNRFCSQESCDARC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 9/33 (27%)
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 9/33 (27%)

Return to query results.
Submit another query.