DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and K11D12.13

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001033498.1 Gene:K11D12.13 / 3896821 WormBaseID:WBGene00044535 Length:188 Species:Caenorhabditis elegans


Alignment Length:73 Identity:16/73 - (21%)
Similarity:30/73 - (41%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILLVFCLQQSYSIKRRCLQPLDVGKG-----KAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNT 68
            :||:.:.....:....:|..|...|..     :|.:| :.::..:..|..|.:.|...|.||:.|
 Worm     5 IILIFYSFMVVFGHPPKCYLPQAKGTSSNCSYEASIR-YHFDPKTNICHAFKYEGCGGNVNNYET 68

  Fly    69 QARCHKIC 76
            ...|.:.|
 Worm    69 PGDCGQNC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 13/54 (24%)
K11D12.13NP_001033498.1 Kunitz-type 22..76 CDD:438633 13/54 (24%)

Return to query results.
Submit another query.