DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and CG13748

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:51 Identity:17/51 - (33%)
Similarity:23/51 - (45%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            ||.|...|..:|.:..|.|:...::|..|.|.|...|.|||.:...|...|
  Fly    60 CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 16/49 (33%)
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 17/51 (33%)

Return to query results.
Submit another query.