DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and K12G11.6

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001024057.2 Gene:K12G11.6 / 3565780 WormBaseID:WBGene00010792 Length:186 Species:Caenorhabditis elegans


Alignment Length:73 Identity:20/73 - (27%)
Similarity:34/73 - (46%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLVFCLQQSYSIKRRCLQPLDVGK---GKAYLR-NWFYNSTSQRCQRFIFYGGASNGNNFNTQA 70
            :|:|.||   :|:...|..|.:.|.   |||... .::::...:.|..|::.|...|.|.|:...
 Worm     7 MLIVLCL---FSLSHSCQDPPNRGHTKCGKAQKSIKYYFDKKLEMCLPFLYSGCGGNTNRFDDSE 68

  Fly    71 RCHKICLA 78
            .|:..|.|
 Worm    69 MCNLRCRA 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 13/53 (25%)
K12G11.6NP_001024057.2 KU 20..74 CDD:197529 13/53 (25%)

Return to query results.
Submit another query.