DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and CG3604

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster


Alignment Length:69 Identity:20/69 - (28%)
Similarity:38/69 - (55%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLAQVSLPIN 85
            ::...|.||.:.|:..|....:.||..:|.|:.|::.|.|.|.|||.::.:|.:.||.:.::...
  Fly    50 TVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSAVSST 114

  Fly    86 FNST 89
            .::|
  Fly   115 DSTT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/49 (35%)
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 17/49 (35%)

Return to query results.
Submit another query.