DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and Col28a1

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001418648.1 Gene:Col28a1 / 312115 RGDID:1564680 Length:1141 Species:Rattus norvegicus


Alignment Length:66 Identity:21/66 - (31%)
Similarity:33/66 - (50%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQQSYSIKR--RCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLA 78
            ||...|:.:  ||.:.|..|....|:..|:|:.....|.||.|.|...:||.|:::..|.:.|:.
  Rat  1076 LQSEKSLYKDPRCEEALKPGNCGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECQETCIK 1140

  Fly    79 Q 79
            |
  Rat  1141 Q 1141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 15/49 (31%)
Col28a1NP_001418648.1 vWFA_subfamily_ECM 47..212 CDD:238727
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
Collagen 713..772 CDD:460189
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.