DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and Wfikkn2

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001385521.1 Gene:Wfikkn2 / 287631 RGDID:1305361 Length:571 Species:Rattus norvegicus


Alignment Length:51 Identity:21/51 - (41%)
Similarity:28/51 - (54%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |..|...|..|||:..|.|||.:..||.|::.|...|||||.::..|.:.|
  Rat   381 CSLPALQGPCKAYVPRWAYNSQTGLCQSFVYGGCEGNGNNFESREACEESC 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 20/49 (41%)
Wfikkn2NP_001385521.1 WAP 37..86 CDD:459672
KAZAL_FS 133..169 CDD:238052
IgI_3_WFIKKN-like 205..299 CDD:409422
Ig strand A 205..208 CDD:409422
Ig strand A' 213..216 CDD:409422
Ig strand B 221..228 CDD:409422
Ig strand C 235..240 CDD:409422
Ig strand C' 241..243 CDD:409422
Ig strand D 245..250 CDD:409422
Ig strand E 258..264 CDD:409422
Ig strand F 278..286 CDD:409422
Ig strand G 289..299 CDD:409422
Kunitz_WFIKKN_1-like 322..373 CDD:438648
Kunitz_WFIKKN_2-like 380..432 CDD:438649 21/51 (41%)
NTR_WFIKKN 450..558 CDD:239630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.