DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and Wfikkn2

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:XP_006533560.1 Gene:Wfikkn2 / 278507 MGIID:2669209 Length:585 Species:Mus musculus


Alignment Length:71 Identity:25/71 - (35%)
Similarity:36/71 - (50%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SCLLILLVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQA 70
            :|:|.    |:....:|   |..|...|..|||:..|.|||.:..||.|::.|...|||||.::.
Mouse   382 ACMLA----CMSGPLAI---CSLPALQGPCKAYVPRWAYNSQTGLCQSFVYGGCEGNGNNFESRE 439

  Fly    71 RCHKIC 76
            .|.:.|
Mouse   440 ACEESC 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 20/49 (41%)
Wfikkn2XP_006533560.1 WAP 51..100 CDD:459672
KAZAL_FS 147..183 CDD:238052
IgI_3_WFIKKN-like 219..313 CDD:409422
Ig strand A 219..222 CDD:409422
Ig strand A' 227..230 CDD:409422
Ig strand B 235..242 CDD:409422
Ig strand C 249..254 CDD:409422
Ig strand C' 255..257 CDD:409422
Ig strand D 259..264 CDD:409422
Ig strand E 272..278 CDD:409422
Ig strand F 292..300 CDD:409422
Ig strand G 303..313 CDD:409422
Kunitz_WFIKKN_1-like 336..387 CDD:438648 2/8 (25%)
Kunitz_WFIKKN_2-like 394..446 CDD:438649 22/55 (40%)
NTR_WFIKKN 464..572 CDD:239630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.