DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and K11D12.11

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_504352.2 Gene:K11D12.11 / 260212 WormBaseID:WBGene00019650 Length:195 Species:Caenorhabditis elegans


Alignment Length:37 Identity:11/37 - (29%)
Similarity:21/37 - (56%) Gaps:1/37 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLA 78
            ::.::.::.|..|.:.|...|.|||:|..:|.: |.|
 Worm    45 FYMDADTETCLAFKYSGCGGNSNNFDTWGKCMR-CFA 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 9/33 (27%)
K11D12.11NP_504352.2 KU 24..77 CDD:197529 9/31 (29%)

Return to query results.
Submit another query.