DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and AMBP

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:45 Identity:20/45 - (44%)
Similarity:27/45 - (60%) Gaps:2/45 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC--LAQVSLPI 84
            :|||.||..|:.|.:.|...|||||.|:..|.:.|  :|..:|||
Human   247 YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 15/33 (45%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226
Kunitz_bikunin_1-like 229..282 CDD:438639 15/34 (44%)
Kunitz_bikunin_2-like 284..338 CDD:438640 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.