DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and T21D12.7

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001343686.1 Gene:T21D12.7 / 24104914 WormBaseID:WBGene00020648 Length:661 Species:Caenorhabditis elegans


Alignment Length:69 Identity:18/69 - (26%)
Similarity:33/69 - (47%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLAQ 79
            |.|::..|.:..:.| ....|......::::|:|:.|:.|.|.|...|.|||..:..|...|.::
 Worm   129 CCQKAGRICQASVHP-GTPCGVPPATRYYFDSSSKTCRPFAFTGCGGNENNFKGKGECMMFCSSE 192

  Fly    80 VSLP 83
            :..|
 Worm   193 IICP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 13/49 (27%)
T21D12.7NP_001343686.1 Kunitz_BPTI 31..86 CDD:425421
Kunitz_BPTI 136..189 CDD:425421 14/53 (26%)
Lustrin_cystein 397..444 CDD:464222
Lustrin_cystein 508..553 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.