DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and Wfikkn1

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001093924.1 Gene:Wfikkn1 / 215001 MGIID:2670967 Length:552 Species:Mus musculus


Alignment Length:51 Identity:16/51 - (31%)
Similarity:23/51 - (45%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |..|...|..:.:...|.|:...|:|..|::.|...|.|||.|:..|...|
Mouse   363 CALPAVQGPCQGWEPRWAYSPLLQQCHPFVYSGCEGNSNNFETRESCEDAC 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 15/49 (31%)
Wfikkn1NP_001093924.1 WAP 32..81 CDD:459672
KAZAL_FS 124..161 CDD:238052
IgI_3_WFIKKN-like 190..284 CDD:409422
Ig strand A 190..193 CDD:409422
Ig strand A' 198..201 CDD:409422
Ig strand B 206..213 CDD:409422
Ig strand C 220..225 CDD:409422
Ig strand C' 226..228 CDD:409422
Ig strand D 230..235 CDD:409422
Ig strand E 243..249 CDD:409422
Ig strand F 263..271 CDD:409422
Ig strand G 274..284 CDD:409422
Kunitz-type 302..355 CDD:444694
Kunitz_WFIKKN_2-like 362..414 CDD:438649 16/51 (31%)
NTR_like 431..541 CDD:470599
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.