DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and Y49G5A.1

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_504413.1 Gene:Y49G5A.1 / 190090 WormBaseID:WBGene00021731 Length:182 Species:Caenorhabditis elegans


Alignment Length:96 Identity:29/96 - (30%)
Similarity:44/96 - (45%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISCLLILL--VFCLQQSYS-IKRRCLQPLDVGK-----GKAYLRNWFYNSTSQRCQRFIFYGGAS 61
            ::.||..|  :.|:.:..| ::..|..|||:||     ||..:| :.::..|.....|.:.|...
 Worm     1 MNLLLTFLATILCVSELVSTLQPECKLPLDMGKTPCKNGKKEIR-YHFDQKSNIPLAFEYSGCGG 64

  Fly    62 NGNNFNTQARCHKIC-------LAQVSLPIN 85
            |.|||.|::.|...|       .|..|.|||
 Worm    65 NKNNFKTESECRFTCTGYDQSGCAAGSKPIN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 18/54 (33%)
Y49G5A.1NP_504413.1 Kunitz-type 25..79 CDD:438633 18/54 (33%)

Return to query results.
Submit another query.