DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and T21D12.12

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_499892.1 Gene:T21D12.12 / 188695 WormBaseID:WBGene00020651 Length:183 Species:Caenorhabditis elegans


Alignment Length:94 Identity:24/94 - (25%)
Similarity:40/94 - (42%) Gaps:15/94 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFKISCLLILLVFCLQQSYSIKRRCLQPLDVGK---GKAYLRNWFYNSTSQRCQRFIFYGGASN 62
            ||..|:...|.:.||..|.   :..|....|.|.   |:...|:::::..::.||.|.:.|...|
 Worm     1 MLTAITISTIFITFCFAQQ---QTDCFSARDTGNSGCGQQGARSFYFHKNTRTCQPFFYQGCDGN 62

  Fly    63 GNNFNTQARCHKICLAQVSLPINFNSTAA 91
            .|.|.::..|...|.         |:||:
 Worm    63 SNRFQSKEACESACR---------NATAS 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 13/52 (25%)
T21D12.12NP_499892.1 Kunitz_BPTI 23..77 CDD:425421 13/53 (25%)
KU 127..182 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.