DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and mec-1

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_741559.3 Gene:mec-1 / 188259 WormBaseID:WBGene00003165 Length:2007 Species:Caenorhabditis elegans


Alignment Length:66 Identity:21/66 - (31%)
Similarity:35/66 - (53%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLAQVSLPINFN 87
            |.|||:|:::|..:.....::|:..|:.|:.|.:.|...|.|.|.|.::|..:|.|       ||
 Worm  1531 KFRCLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRFMTVSQCENLCFA-------FN 1588

  Fly    88 S 88
            |
 Worm  1589 S 1589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 14/49 (29%)
mec-1NP_741559.3 Kunitz_BPTI 45..97 CDD:425421
EGF_CA 202..240 CDD:214542
Kunitz-type <265..304 CDD:444694
Kunitz_TAP-like 408..472 CDD:438634
Kunitz_TAP-like 615..675 CDD:438634
Kunitz_TAP-like 857..915 CDD:438634
Kunitz-type <1121..1160 CDD:444694
KU 1261..1311 CDD:197529
Kunitz-type <1338..1379 CDD:444694
Kunitz-type 1390..1446 CDD:438633
Kunitz-type 1458..1514 CDD:444694
Kunitz-type 1534..1584 CDD:438633 14/49 (29%)
Kunitz-type 1597..1654 CDD:438633
Kunitz_BPTI 1673..1728 CDD:425421
Kunitz-type 1740..1790 CDD:438633
Kunitz-type 1798..1849 CDD:438633
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.