DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and K11D12.6

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_504350.1 Gene:K11D12.6 / 187293 WormBaseID:WBGene00019646 Length:186 Species:Caenorhabditis elegans


Alignment Length:88 Identity:29/88 - (32%)
Similarity:42/88 - (47%) Gaps:8/88 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILLVFCLQQSYSIKRRCLQPLDVGKGK----AYLRNWFYNSTSQRCQRFIFYGGASNGNNFNT 68
            :|:||.|....|.| :..|..|:|:|..|    :.:| :.|:.|.:||..|.:.|...|.|||..
 Worm     2 ILLLLPFLFGASVS-QNICDSPVDLGTAKCSNTSSIR-YHYDPTVKRCLPFGYTGCGGNENNFAD 64

  Fly    69 QARCHKICLAQVS--LPINFNST 89
            ...|.:.|:.|..  .|.|..||
 Worm    65 PRICRQRCIPQDHHVCPANTPST 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/53 (32%)
K11D12.6NP_504350.1 Kunitz_BPTI 18..72 CDD:425421 17/54 (31%)

Return to query results.
Submit another query.