DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and piit-1

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_505943.2 Gene:piit-1 / 185259 WormBaseID:WBGene00009384 Length:200 Species:Caenorhabditis elegans


Alignment Length:79 Identity:22/79 - (27%)
Similarity:34/79 - (43%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFKISCLLILLVFCLQQSYSIKRRCLQPLDVGK---GKAYLRNWFYNSTSQRCQRFIFYGGASN 62
            |..:::.:|.||.|...||.|:.  |....|.|.   ..:..|.::|......||.|::.|...|
 Worm     1 MALRLAVILSLLSFTAAQSTSVD--CFAARDSGNTCAENSSSRMFYYLPRLGTCQPFMYQGCGGN 63

  Fly    63 GNNFNTQARCHKIC 76
            .|.|::...|...|
 Worm    64 SNRFSSAQECRSAC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 13/52 (25%)
piit-1NP_505943.2 Kunitz_BPTI 24..77 CDD:425421 13/52 (25%)
KU 137..192 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.