DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and C10G8.2

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_504418.1 Gene:C10G8.2 / 182501 WormBaseID:WBGene00015681 Length:208 Species:Caenorhabditis elegans


Alignment Length:34 Identity:8/34 - (23%)
Similarity:15/34 - (44%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YNSTSQRCQRFIFYGGASNGNNFNTQARCHKICL 77
            ::.::..|..|.:.|.....|.|::...|...||
 Worm    46 FDQSTGLCMNFRWDGCKDQENKFDSLQECASTCL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 6/31 (19%)
C10G8.2NP_504418.1 Kunitz_BPTI <38..78 CDD:425421 6/31 (19%)

Return to query results.
Submit another query.