DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and C34F6.1

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_509868.1 Gene:C34F6.1 / 181306 WormBaseID:WBGene00007938 Length:1043 Species:Caenorhabditis elegans


Alignment Length:78 Identity:26/78 - (33%)
Similarity:44/78 - (56%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |..|.:.| .:...||..::||:|||.|:.::||:.|:||..|::.|...|.|||.:..:|.:.|
 Worm   339 LTACCENS-GLTDPCLLSINVGQGKALLKRFYYNTFSKRCTEFMYKGTKGNENNFLSYTQCQEKC 402

  Fly    77 LA---QVSLPINF 86
            ..   ...:|:|:
 Worm   403 QKWDNPCPVPVNY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 20/49 (41%)
C34F6.1NP_509868.1 Lustrin_cystein 185..231 CDD:464222
Kunitz_conkunitzin 239..289 CDD:438636
Lustrin_cystein 304..343 CDD:464222 1/3 (33%)
Kunitz_conkunitzin 352..402 CDD:438636 20/49 (41%)
Kunitz_conkunitzin 457..511 CDD:438636
Kunitz_conkunitzin 566..616 CDD:438636
Lustrin_cystein 622..663 CDD:464222
Kunitz_conkunitzin 669..719 CDD:438636
Lustrin_cystein 725..767 CDD:464222
Kunitz_conkunitzin 773..823 CDD:438636
Lustrin_cystein 828..873 CDD:464222
Kunitz_conkunitzin 880..930 CDD:438636
Kunitz_BPTI 982..1033 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.