DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and mlt-11

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001256938.1 Gene:mlt-11 / 180352 WormBaseID:WBGene00012186 Length:3129 Species:Caenorhabditis elegans


Alignment Length:75 Identity:24/75 - (32%)
Similarity:35/75 - (46%) Gaps:15/75 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICL------------ 77
            ||....|.|.||.|...|::|..:.||::|:|.|...|.|.|.|.:.|.:||.            
 Worm  2240 RCSFDKDSGSGKGYNVKWYFNMKNLRCEQFVFEGLGGNTNQFETLSECERICTPSGPKTPTLPPT 2304

  Fly    78 ---AQVSLPI 84
               |.|::|:
 Worm  2305 PTPATVAVPV 2314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 18/49 (37%)
mlt-11NP_001256938.1 TY <361..409 CDD:238114
Kunitz-type 429..473 CDD:438633
Kunitz_BPTI 538..590 CDD:425421
Kunitz-type 737..787 CDD:438633
Kunitz_BPTI 803..855 CDD:425421
Kunitz_BPTI 865..917 CDD:425421
Kunitz-type 1083..1133 CDD:438633
Kunitz_BPTI 2176..2228 CDD:425421
Kunitz_ixolaris_2 2241..2291 CDD:438669 18/49 (37%)
Kunitz_BPTI 2742..2793 CDD:425421
Lustrin_cystein 2910..2956 CDD:464222
Kunitz_BPTI 3070..3128 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.