DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and Y43F8B.3

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001256874.1 Gene:Y43F8B.3 / 180277 WormBaseID:WBGene00012814 Length:1658 Species:Caenorhabditis elegans


Alignment Length:57 Identity:22/57 - (38%)
Similarity:33/57 - (57%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLAQVSL 82
            |.||:.||.|.|.|..|:||:.:.:|.:|.:.|...|.|||.:|..|.:.|...|::
 Worm   862 CQQPMAVGTGGATLPRWYYNAQTMQCVQFNYAGRMGNQNNFQSQQACEQTCPVYVNV 918

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 20/49 (41%)
Y43F8B.3NP_001256874.1 Kunitz-type 76..126 CDD:438633
Kunitz-type 131..181 CDD:438633
Kunitz_conkunitzin 232..282 CDD:438636
Lustrin_cystein 286..329 CDD:464222
Kunitz_conkunitzin 336..386 CDD:438636
Kunitz_conkunitzin 440..490 CDD:438636
Lustrin_cystein 497..540 CDD:464222
Kunitz_conkunitzin 546..596 CDD:438636
Kunitz_conkunitzin 651..702 CDD:438636
Kunitz_conkunitzin 754..804 CDD:438636
Lustrin_cystein 810..853 CDD:464222
Kunitz_conkunitzin 862..912 CDD:438636 20/49 (41%)
Lustrin_cystein 918..962 CDD:464222 0/1 (0%)
Kunitz_conkunitzin 973..1025 CDD:438636
Kunitz_conkunitzin 1077..1127 CDD:438636
Lustrin_cystein 1131..1176 CDD:464222
Kunitz_conkunitzin 1183..1233 CDD:438636
Lustrin_cystein 1244..1282 CDD:464222
Kunitz_conkunitzin 1288..1338 CDD:438636
Kunitz_conkunitzin 1396..1446 CDD:438636
Kunitz_conkunitzin 1499..1549 CDD:438636
Kunitz-type 1602..1652 CDD:438633
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.