DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and F22E12.1

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:84 Identity:30/84 - (35%)
Similarity:39/84 - (46%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILLVFCL----QQSYSIKRRCLQPLDVGKGKA-YLRNWFYNSTSQRCQRFIFYGGA-SNGNNF 66
            :||||..|.    ||..| ..:|....|.|..:. :...|:|:....||:|| ||||. .|.|.|
 Worm     4 VLILLFGCTAVNSQQLLS-NPKCNHWPDRGTCELDFHVKWYYDRYDHRCRRF-FYGGCEGNENRF 66

  Fly    67 NTQARCHKICLAQVSLPIN 85
            ::...|...|..||  |.|
 Worm    67 DSLEECSSQCHYQV--PTN 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/51 (33%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 17/51 (33%)
KU 85..137 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.