DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and mec-9

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001256153.1 Gene:mec-9 / 179382 WormBaseID:WBGene00003173 Length:838 Species:Caenorhabditis elegans


Alignment Length:59 Identity:20/59 - (33%)
Similarity:29/59 - (49%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGK-GKAYLRNW--FYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLAQVS 81
            ||...|.|. |.....:|  |:|..|..|::|.:||...|.|.|.:...|.|:|..::|
 Worm   100 CLLDADQGHCGDERNGHWWYFFNQESGECEKFFYYGCGGNDNKFYSLHMCRKVCGERLS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 18/52 (35%)
mec-9NP_001256153.1 Kunitz_BPTI 35..87 CDD:425421
Kunitz_BPTI 100..154 CDD:425421 18/53 (34%)
EGF_CA 199..229 CDD:429571
EGF_3 252..277 CDD:463759
EGF_3 283..318 CDD:463759
KU 323..381 CDD:197529
KU <408..449 CDD:197529
KU 460..516 CDD:197529
EGF_CA 550..586 CDD:238011
EGF 639..671 CDD:394967
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.