DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and K11D12.7

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_504351.1 Gene:K11D12.7 / 178891 WormBaseID:WBGene00019647 Length:187 Species:Caenorhabditis elegans


Alignment Length:78 Identity:20/78 - (25%)
Similarity:34/78 - (43%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISCLLILLVFCL-QQSYSIKRRCLQPLDVG----KGKAYLRNWFYNSTSQRCQRFIFYGGASNGN 64
            :..||.:.:.|| ..|...:..|..||..|    ...:.:| :.::..|::|..|.:.|...|.|
 Worm     2 LKVLLAIGLLCLIDVSAQFRAECEHPLHFGVQQCTNTSVVR-YHFDMESKKCLAFKYTGCGGNEN 65

  Fly    65 NFNTQARCHKICL 77
            ||...:.|...|:
 Worm    66 NFKDYSACSNFCI 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 14/53 (26%)
K11D12.7NP_504351.1 Kunitz_BPTI 24..77 CDD:425421 14/53 (26%)

Return to query results.
Submit another query.