DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and F30H5.3

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_497206.1 Gene:F30H5.3 / 175207 WormBaseID:WBGene00017937 Length:1599 Species:Caenorhabditis elegans


Alignment Length:51 Identity:19/51 - (37%)
Similarity:28/51 - (54%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |.|||.:|..|..:|.::||:.::.|:.|.:.|...|.|||.|...|...|
 Worm   563 CSQPLRLGDCKQSVRRYWYNAVTRACEIFDYTGCQGNDNNFETLLECQNTC 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 18/49 (37%)
F30H5.3NP_497206.1 EB 135..182 CDD:460294
KU 330..391 CDD:197529
KU <481..516 CDD:197529
Kunitz_BPTI 562..613 CDD:425421 18/49 (37%)
Kunitz_BPTI 669..723 CDD:425421
Kunitz_BPTI 776..829 CDD:425421
Lustrin_cystein 834..879 CDD:464222
Lustrin_cystein 885..930 CDD:464222
Lustrin_cystein 1105..1150 CDD:464222
EB 1212..1263 CDD:460294
EB 1267..1318 CDD:460294
Lustrin_cystein 1466..1511 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.