DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and C49H3.16

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001255308.1 Gene:C49H3.16 / 13196868 WormBaseID:WBGene00219436 Length:206 Species:Caenorhabditis elegans


Alignment Length:41 Identity:16/41 - (39%)
Similarity:27/41 - (65%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKICLAQVSL 82
            |:|::.|:||:|| .:.|..|.|.|.::.:|.:.| :|.||
 Worm   163 WYYDNESRRCERF-SWSGCGNQNRFASKMQCEQTC-SQNSL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 12/33 (36%)
C49H3.16NP_001255308.1 PHA03247 <31..126 CDD:223021
PRK10856 <60..>106 CDD:236776
Kunitz-type 147..196 CDD:438633 12/33 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.