DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and WFIKKN1

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_444514.1 Gene:WFIKKN1 / 117166 HGNCID:30912 Length:548 Species:Homo sapiens


Alignment Length:51 Identity:16/51 - (31%)
Similarity:26/51 - (50%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |:.|...|..:.:...|.|:...|:|..|::.|...|||||:::..|...|
Human   359 CVLPAVQGPCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDAC 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 15/49 (31%)
WFIKKN1NP_444514.1 WAP 29..78 CDD:459672
KAZAL_FS 120..155 CDD:238052
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..184
IgI_3_WFIKKN-like 186..280 CDD:409422
Ig strand A 186..189 CDD:409422
Ig strand A' 194..197 CDD:409422
Ig strand B 202..209 CDD:409422
Ig strand C 216..221 CDD:409422
Ig strand C' 222..224 CDD:409422
Ig strand D 226..231 CDD:409422
Ig strand E 239..245 CDD:409422
Ig strand F 259..267 CDD:409422
Ig strand G 270..280 CDD:409422
Kunitz-type 298..351 CDD:444694
Kunitz_WFIKKN_2-like 358..410 CDD:438649 16/51 (31%)
NTR_WFIKKN 427..537 CDD:239630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.