DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and Ambp

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus


Alignment Length:62 Identity:18/62 - (29%)
Similarity:33/62 - (53%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |||...:| ..|..|:..|..:|:::.|.:::...:|.:|.:.|...|||.|.::..|.:.|
Mouse   276 CLQTCRTI-AACNLPIVQGPCRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 13/49 (27%)
AmbpNP_031469.1 lipocalin_A1M-like 27..189 CDD:381193
Kunitz_bikunin_1-like 228..281 CDD:438639 3/4 (75%)
Kunitz_bikunin_2-like 284..337 CDD:438640 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.