DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and CG42828

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster


Alignment Length:76 Identity:22/76 - (28%)
Similarity:36/76 - (47%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFKISCLLILLVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNN 65
            :|.:..|||.:|:..::.:...|..|..|.:.||...:...|.:::..|.|..|:|.....|.|.
  Fly     3 LLTQFLCLLAVLLSTVESAEKRKAFCYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGNENR 67

  Fly    66 FNTQARCHKIC 76
            |.|:..|.|.|
  Fly    68 FYTKENCEKAC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 15/49 (31%)
CG42828NP_001189271.1 KU 27..78 CDD:197529 15/50 (30%)

Return to query results.
Submit another query.