DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and CG42717

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001189115.1 Gene:CG42717 / 10178897 FlyBaseID:FBgn0261634 Length:96 Species:Drosophila melanogaster


Alignment Length:55 Identity:17/55 - (30%)
Similarity:25/55 - (45%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RCLQPLDVG-------KGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARC 72
            :|...||.|       |..|....|.||:.::.|.:|.:.|...|.|.:.|:|.|
  Fly    35 KCAGNLDGGNNRKSKCKKSANKNMWHYNTRTKNCTQFNYLGCGGNNNRWCTKALC 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/54 (31%)
CG42717NP_001189115.1 Kunitz-type <57..90 CDD:444694 11/33 (33%)

Return to query results.
Submit another query.