DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and col28a1b

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001289178.1 Gene:col28a1b / 100332225 ZFINID:ZDB-GENE-160503-1 Length:1109 Species:Danio rerio


Alignment Length:66 Identity:24/66 - (36%)
Similarity:38/66 - (57%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76
            |:|  ||.::...|||||||.|..:.|:..|:::..:..|.:|.|.|...|.|.|:::..|.|.|
Zfish  1044 LIF--QQDFTADERCLQPLDPGPCREYVVKWYFDPKANSCAQFWFGGCKGNKNQFDSELTCRKTC 1106

  Fly    77 L 77
            :
Zfish  1107 V 1107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 18/49 (37%)
col28a1bNP_001289178.1 VWA 45..226 CDD:459670
gly_rich_SclB <243..>313 CDD:468478
gly_rich_SclB <291..>568 CDD:468478
gly_rich_SclB <491..>773 CDD:468478
vWFA 797..987 CDD:469594
Kunitz_collagen_alpha1_XXVIII 1056..1106 CDD:438671 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.