DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34276 and col28a2a

DIOPT Version :10

Sequence 1:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001153314.2 Gene:col28a2a / 100294690 ZFINID:ZDB-GENE-030131-4444 Length:1208 Species:Danio rerio


Alignment Length:63 Identity:19/63 - (30%)
Similarity:31/63 - (49%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGA-SNGNNFNTQARCHKICL 77
            :::|..:..||......|..:.|:..|:|...|..|.:| :|||. .|.|.|:|:..|...|:
Zfish  1142 IKESAPLDPRCQLSFVQGSCRNYVIRWYYEKQSNSCAQF-WYGGCDGNDNRFHTEEECKTTCV 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 16/50 (32%)
col28a2aNP_001153314.2 VWA 61..242 CDD:459670
gly_rich_SclB <260..>560 CDD:468478
gly_rich_SclB <511..>795 CDD:468478
VWA 816..995 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1152..1202 CDD:438671 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.