DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and Endou

DIOPT Version :9

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001177998.1 Gene:Endou / 680317 RGDID:1593011 Length:411 Species:Rattus norvegicus


Alignment Length:286 Identity:93/286 - (32%)
Similarity:144/286 - (50%) Gaps:29/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TPDDVLTLSKNLY------AEETEVSPYLYKVNLQGKTTSGAHDDRAPRNLFE-LHQDLLARDAN 110
            |.:::.::|:.:|      |::.::  .|...|......:|...||.|..||: :::.|.::   
  Rat   137 TKEELKSISETIYRVDINKAQKKDI--VLNSQNQISPAETGNQVDRCPEPLFKYVNEKLFSK--- 196

  Fly   111 STTALLMRLFDNYELDVAVQEHPTPEHVQEQYDFLRAVMGTRVMKLTMRFLVHKDIVSVEYDDQL 175
            .|.|..:.|.:||:......||.:.:.::||..|||.||.|.|||....||.|::    .|..|.
  Rat   197 PTYAAFINLLNNYQRATGHGEHFSAQQLEEQVVFLREVMKTAVMKELYSFLRHQN----RYGSQQ 257

  Fly   176 RLLQEL---WFTPYSRGRGIVGSSSFEHVFMAEIRDQKVLGLHNWLYFADQEQRGNVDYKGWLNH 237
            ..:::|   ||..||||.....||.|||||..|::..||.|.|||:.|..||:.|.:||   .:|
  Rat   258 EFVEDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLQEKEGLLDY---YSH 319

  Fly   238 KEMGKHNQM--VLSVRYTFHNINKPVNGFFVGISPELDMALYTACFLATAKEEPCHIQLGHASAT 300
            ...|..:..  ||::::.:....|.|...|:|.|||.:.|||:.||: |...:.||:.||.....
  Rat   320 NYDGPWDSYPDVLAMQFNWDGYYKEVGSVFIGSSPEFEFALYSLCFI-TRPGKKCHLSLGGYPLA 383

  Fly   301 IVSHEWK----WNGMRLIGTVYPDSS 322
            |.::.|.    .||.:.|.|.|..||
  Rat   384 IQTYTWDKTTYGNGKKYIATAYVVSS 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 55..319 CDD:286496 89/279 (32%)
EndouNP_001177998.1 Somatomedin_B 22..60 CDD:279385
Somatomedin_B 88..125 CDD:279385
XendoU 139..405 CDD:286496 89/278 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352172
Domainoid 1 1.000 161 1.000 Domainoid score I3916
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4541
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 1 1.000 - - otm45493
orthoMCL 1 0.900 - - OOG6_102937
Panther 1 1.100 - - O PTHR12439
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.