DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and endouc

DIOPT Version :9

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001038439.1 Gene:endouc / 562040 ZFINID:ZDB-GENE-060503-141 Length:309 Species:Danio rerio


Alignment Length:253 Identity:91/253 - (35%)
Similarity:135/253 - (53%) Gaps:14/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YKVNLQGKT---TSGAHD--DRAPRNLFELHQDLLARDANSTTALLMRLFDNYELDVAVQEHPTP 135
            |.::||||.   ..|:.:  |.|...|| ::.|.....:.:|.|..|:|.||||....|.|..|.
Zfish    52 YNISLQGKAGYIPQGSTNVVDHASSPLF-VNVDEAKLSSITTYARFMKLLDNYERSTGVAERVTA 115

  Fly   136 EHVQEQYDFLRAVMGTRVMKLTMRFLVHKDIVSVEYDDQLRLLQELWFTPYSRGR-GIVGSSSFE 199
            |.|.|...||.|::.|.|||...::|:.|.....:.......|..:||..|.|.| |...||.||
Zfish   116 EEVTENNSFLDAILETAVMKRAHQYLIGKGKSRSDLRQFKSQLYYMWFRLYHRERNGGEDSSGFE 180

  Fly   200 HVFMAEIR-DQKVLGLHNWLYFADQEQRGNVDYKGW-LNHKEMGKHNQMVLSVRYTFHNINKPVN 262
            |||:.|.: .::::|||||:.|..||::..:||||: ....::...:..||:|::::|.:.|||.
Zfish   181 HVFVGETKFGREIMGLHNWVQFYLQEKQNLLDYKGYKARANDVPDADDHVLNVQFSWHGLVKPVA 245

  Fly   263 GFFVGISPELDMALYTACFL-ATAKEEPCHIQLGHASATIVSHEWKWNGMRLIGTVYP 319
            ..|||:|||.:||::|..|| :|.|.....:.|......:|.|.   :| |.|||.||
Zfish   246 SAFVGVSPEFEMAVFTILFLTSTEKTTTAVVNLDEYQLEMVVHR---HG-RCIGTAYP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 55..319 CDD:286496 89/251 (35%)
endoucNP_001038439.1 XendoU 28..299 CDD:286496 89/251 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5016
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4576
OMA 1 1.010 - - QHG59792
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102937
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X8250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.