DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and Enpp3

DIOPT Version :9

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_062243.2 Gene:Enpp3 / 54410 RGDID:708511 Length:875 Species:Rattus norvegicus


Alignment Length:71 Identity:16/71 - (22%)
Similarity:27/71 - (38%) Gaps:15/71 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ILSWHFYEYFHSK------------PLPKTPDDVLTLSKNLYAEETEVSPYLYKVNLQGKTTSGA 88
            :|...||:..|::            ||||...:...|:.....:|.:|:   .::||.|...|..
  Rat   542 LLKAPFYQPSHAEELSKSAGCGFTTPLPKDSLNCSCLALQTSGQEEQVN---QRLNLSGGEVSAT 603

  Fly    89 HDDRAP 94
            .....|
  Rat   604 EKTNLP 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 55..319 CDD:286496 8/40 (20%)
Enpp3NP_062243.2 SO 51..94 CDD:197571
Cell attachment site. /evidence=ECO:0000255 79..81
SO 95..138 CDD:197571
Phosphodiesterase 141..510
Phosphodiest 162..486 CDD:396300
Nuclease 605..875 1/5 (20%)
NUC 608..867 CDD:238043 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.