powered by:
Protein Alignment EndoU and Enpp3
DIOPT Version :9
Sequence 1: | NP_650508.1 |
Gene: | EndoU / 41931 |
FlyBaseID: | FBgn0038381 |
Length: | 322 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_062243.2 |
Gene: | Enpp3 / 54410 |
RGDID: | 708511 |
Length: | 875 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 27/71 - (38%) |
Gaps: | 15/71 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 ILSWHFYEYFHSK------------PLPKTPDDVLTLSKNLYAEETEVSPYLYKVNLQGKTTSGA 88
:|...||:..|:: ||||...:...|:.....:|.:|: .::||.|...|..
Rat 542 LLKAPFYQPSHAEELSKSAGCGFTTPLPKDSLNCSCLALQTSGQEEQVN---QRLNLSGGEVSAT 603
Fly 89 HDDRAP 94
.....|
Rat 604 EKTNLP 609
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.