powered by:
Protein Alignment EndoU and AT4G17100
DIOPT Version :9
Sequence 1: | NP_650508.1 |
Gene: | EndoU / 41931 |
FlyBaseID: | FBgn0038381 |
Length: | 322 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_193443.4 |
Gene: | AT4G17100 / 3770328 |
AraportID: | AT4G17100 |
Length: | 844 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 17/71 - (23%) |
Similarity: | 31/71 - (43%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 162 VHKDIVSVEYDDQLRLLQELW-FTPYSRGRGIVGSSSFEHVFMAEIRDQKVLGLHNWLY----FA 221
:...|::.|:.....|.:::| |.|.:.|..:|........::.||:|..|.|. .|.. .|
plant 592 IRSKILAEEFGWDKDLAKKIWAFGPDTTGPNMVVDMCKGVQYLNEIKDSVVAGF-QWASKEGPLA 655
Fly 222 DQEQRG 227
::..||
plant 656 EENMRG 661
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
EndoU | NP_650508.1 |
XendoU |
55..319 |
CDD:286496 |
17/71 (24%) |
AT4G17100 | NP_193443.4 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2849 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102937 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.760 |
|
Return to query results.
Submit another query.