DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and AT4G17100

DIOPT Version :9

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_193443.4 Gene:AT4G17100 / 3770328 AraportID:AT4G17100 Length:844 Species:Arabidopsis thaliana


Alignment Length:71 Identity:17/71 - (23%)
Similarity:31/71 - (43%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 VHKDIVSVEYDDQLRLLQELW-FTPYSRGRGIVGSSSFEHVFMAEIRDQKVLGLHNWLY----FA 221
            :...|::.|:.....|.:::| |.|.:.|..:|........::.||:|..|.|. .|..    .|
plant   592 IRSKILAEEFGWDKDLAKKIWAFGPDTTGPNMVVDMCKGVQYLNEIKDSVVAGF-QWASKEGPLA 655

  Fly   222 DQEQRG 227
            ::..||
plant   656 EENMRG 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 55..319 CDD:286496 17/71 (24%)
AT4G17100NP_193443.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102937
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.760

Return to query results.
Submit another query.