DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and AT4G17100

DIOPT Version :10

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_193443.4 Gene:AT4G17100 / 3770328 AraportID:AT4G17100 Length:437 Species:Arabidopsis thaliana


Alignment Length:71 Identity:17/71 - (23%)
Similarity:31/71 - (43%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 VHKDIVSVEYDDQLRLLQELW-FTPYSRGRGIVGSSSFEHVFMAEIRDQKVLGLHNWLY----FA 221
            :...|::.|:.....|.:::| |.|.:.|..:|........::.||:|..|.|. .|..    .|
plant   592 IRSKILAEEFGWDKDLAKKIWAFGPDTTGPNMVVDMCKGVQYLNEIKDSVVAGF-QWASKEGPLA 655

  Fly   222 DQEQRG 227
            ::..||
plant   656 EENMRG 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 56..319 CDD:462792 17/71 (24%)
AT4G17100NP_193443.4 PLN00116 1..820 CDD:177730 17/71 (24%)

Return to query results.
Submit another query.