DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and CG2145

DIOPT Version :9

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001285102.1 Gene:CG2145 / 32027 FlyBaseID:FBgn0030251 Length:592 Species:Drosophila melanogaster


Alignment Length:269 Identity:115/269 - (42%)
Similarity:166/269 - (61%) Gaps:7/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TPDDVLTLSKNLYAEETEVSPYLYKVNLQGKTTSGAHDDRAPRNLFELHQDLLARDANSTTALLM 117
            |.|::..|::.||.:|:.......:|||||:|.|....|.||..|..:....|    .|.|.:.|
  Fly   329 TDDEIRQLTELLYTKESNSQIGNIQVNLQGRTRSIDSADEAPNPLLTVDSKAL----ESPTIVKM 389

  Fly   118 R-LFDNYELDVAVQEHPTPEHVQEQYDFLRAVMGTRVMKLTMRFLVHKDIVSVEYDDQLRLLQEL 181
            | ||:|||.|..|.||.||...:|:.|||.|||.|.||:..|.||..|.:||.:......|::||
  Fly   390 RLLFNNYEHDTHVNEHVTPNERKEENDFLDAVMATPVMRQAMLFLQQKGVVSPDPKTHRDLVKEL 454

  Fly   182 WFTPYSRGRGIVGSSSFEHVFMAEIRDQKVLGLHNWLYFADQEQRGNVDYKGWLNHKEMGKHNQM 246
            |||.||||:|.:|||.|||||:.|::|..::|.|||:|..|:|:.|..||||::..:::|...::
  Fly   455 WFTQYSRGQGKIGSSGFEHVFVYEVKDGTIIGFHNWVYIGDEEKDGRFDYKGYMKEQDIGTKGKI 519

  Fly   247 VLSVRYTFHNINKPVNGFFVGISPELDMALYTACFLATAKEEPCHIQLGHASATIVSHEWKWNGM 311
            | .:|::...:|||||..|||.||||::||||.|| ....:..|.:.||::...||::.|::.|.
  Fly   520 V-KIRFSHQGLNKPVNTVFVGTSPELELALYTVCF-QLRPDRTCPVSLGNSKFGIVTYSWRYRGK 582

  Fly   312 RLIGTVYPD 320
            .|||:.||:
  Fly   583 NLIGSAYPE 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 55..319 CDD:286496 112/264 (42%)
CG2145NP_001285102.1 XendoU 330..590 CDD:286496 112/265 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467876
Domainoid 1 1.000 138 1.000 Domainoid score I2994
eggNOG 1 0.900 - - E1_KOG2849
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.815465 Normalized mean entropy S5851
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 1 1.000 - - mtm6587
orthoMCL 1 0.900 - - OOG6_102937
Panther 1 1.100 - - P PTHR12439
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.