DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and Endou

DIOPT Version :9

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_032928.1 Gene:Endou / 19011 MGIID:97746 Length:454 Species:Mus musculus


Alignment Length:284 Identity:95/284 - (33%)
Similarity:144/284 - (50%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TPDDVLTLSKNLYAEETEVSP----YLYKVNLQGKTTSGAHDDRAPRNLFE-LHQDLLARDANST 112
            |.:::.::|:.:|..:|..:.    .|...|....:.:|...||:|..||. :::.|.::   .|
Mouse   180 TKEELESISETIYRVDTNKAQKEDIVLNSQNRISPSETGNQVDRSPEPLFTYVNEKLFSK---PT 241

  Fly   113 TALLMRLFDNYELDVAVQEHPTPEHVQEQYDFLRAVMGTRVMKLTMRFLVHKDIVSVE---YDDQ 174
            .|..:.|.:||:......||.:.:.::||..|||.||.|.|||....||.|::..|.|   .|| 
Mouse   242 YAAFINLLNNYQRATGHGEHFSAQQLEEQGVFLREVMKTAVMKELYSFLHHQNRYSSEQEFVDD- 305

  Fly   175 LRLLQELWFTPYSRGRGIVGSSSFEHVFMAEIRDQKVLGLHNWLYFADQEQRGNVDYKGWLNHKE 239
               |:.:||..||||.....||.|||||..|::..||.|.|||:.|..||:.|.:||   .:|..
Mouse   306 ---LKNMWFGLYSRGNDEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLQEKEGLLDY---YSHNY 364

  Fly   240 MGKHNQM--VLSVRYTFHNINKPVNGFFVGISPELDMALYTACFLATAKEEPCHIQLGHASATIV 302
            .|..:..  ||::::.:....|.|...|:|.|||.:.|||:.||: |...:.||:.||.....|.
Mouse   365 DGPWDSYPDVLAMQFNWDGYYKEVGSVFIGSSPEFEFALYSLCFI-TRPGKKCHLSLGGYPLAIQ 428

  Fly   303 SHEWK----WNGMRLIGTVYPDSS 322
            ::.|.    .||.:.|.|.|..||
Mouse   429 TYTWDKTTYGNGKKYIATAYVVSS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 55..319 CDD:286496 91/277 (33%)
EndouNP_032928.1 Somatomedin_B 130..167 CDD:279385
XendoU 182..448 CDD:286496 91/276 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848574
Domainoid 1 1.000 168 1.000 Domainoid score I3819
eggNOG 1 0.900 - - E1_KOG2849
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4575
Isobase 1 0.950 - 0.815465 Normalized mean entropy S5851
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 1 1.000 - - otm43429
orthoMCL 1 0.900 - - OOG6_102937
Panther 1 1.100 - - O PTHR12439
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.700

Return to query results.
Submit another query.