DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and endu-2

DIOPT Version :9

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_509391.1 Gene:endu-2 / 181079 WormBaseID:WBGene00019779 Length:572 Species:Caenorhabditis elegans


Alignment Length:235 Identity:64/235 - (27%)
Similarity:107/235 - (45%) Gaps:26/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NLQGKT-TSGAHDDRAPRNLFELHQDLLARDANSTTALLMRLFDNYELDVAVQEHPTPEHVQEQY 142
            ::.||| |.||       |||....:.:.........:.....|.:..||...| |.....::||
 Worm   337 HISGKTGTKGA-------NLFTTVDESIFTKKQYADLITTYTQDLFTADVCKAE-PAMGGFRKQY 393

  Fly   143 DFLRAVMGTRVMKLTMRFL-VHKDIVSVEYDD-------QLRLLQELWFTPYSRGRGIVGSSSFE 199
              |:.|..|  ...|..|. ....:.|:.|.:       :.::|..|||..|:|.:|.:|||.:|
 Worm   394 --LQGVFNT--FTATPMFASAFAYLQSINYKETSNLTNFKTKVLWPLWFGTYTRCKGPLGSSGWE 454

  Fly   200 HVFMAEIRDQKVLGLHNWLYFADQEQRGNVDYKGWLNHKEMGKHNQMVLSVRYTFHNINKPVNGF 264
            |||..||:..:|.|.|:|:.:..:::...:.|.|:..|.|     .::.:.:|.::...||..||
 Worm   455 HVFSGEIKSNEVDGQHDWVRYYTEQKADKMVYDGYYTHDE-----NLIGTFQYKWNGALKPKGGF 514

  Fly   265 FVGISPELDMALYTACFLATAKEEPCHIQLGHASATIVSH 304
            |.|.||..|.::.:.|.||......||.::.:...|:.|:
 Worm   515 FTGTSPAFDFSILSVCALAHGNGGNCHFKVTNYPITVTSY 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 55..319 CDD:286496 64/235 (27%)
endu-2NP_509391.1 XendoU 48..248 CDD:286496
XendoU 307..571 CDD:286496 64/235 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.815465 Normalized mean entropy S5851
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102937
Panther 1 1.100 - - O PTHR12439
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.