DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoU and endou

DIOPT Version :9

Sequence 1:NP_650508.1 Gene:EndoU / 41931 FlyBaseID:FBgn0038381 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002935698.3 Gene:endou / 100490819 XenbaseID:XB-GENE-987190 Length:418 Species:Xenopus tropicalis


Alignment Length:289 Identity:86/289 - (29%)
Similarity:138/289 - (47%) Gaps:43/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DDVLTLSKNLYAEETEVSPYLYKVNLQGKT------TSGAHDDRAPRNLFE------LHQDLLAR 107
            |::..:|:.||.::         ||..|::      ...||:.|...:|.|      :::.|..|
 Frog   151 DEIKAVSEKLYKQD---------VNKAGESDIILNKQEMAHNTREQEDLCEEPLYKYVNEQLFKR 206

  Fly   108 DANSTTALLMRLFDNYELDVAVQEHPTPEHVQEQYDFLRAVMGTRVMKLTMRFLVHKDIVSVEYD 172
               .|.|..:.|.|||:....:.|..:...::||..||:.:|.|::||....|...|.:...| .
 Frog   207 ---PTYAAFIALLDNYDRKTGIDESYSAAEIKEQERFLQEIMKTQIMKELFSFFHSKGLYQTE-K 267

  Fly   173 DQLRLLQELWFTPYSRGRGIVGSSSFEHVFMAEIRDQKVLGLHNWLYFADQEQRGNVDYKG---- 233
            :.::.||::||..|||..|...||.|||||:.|::...|.|.|||:.|...|::|.:||..    
 Frog   268 EFVKDLQKMWFGLYSRSTGEADSSGFEHVFVGEVKKGIVSGFHNWIRFYMLEKKGLLDYYSHNFD 332

  Fly   234 --WLNHKEMGKHNQMVLSVRYTFHNINKPVNGFFVGISPELDMALYTACFLATAKEEPCHIQLGH 296
              |.::.:       ||..::.:....|.|...|:|.|||.|.::||.||::....: |.|.||.
 Frog   333 GPWTSYPD-------VLGQQFYWDGFYKEVGSQFIGSSPEFDFSIYTLCFISRPGRK-CKISLGG 389

  Fly   297 ASATIVSHEWKW----NGMRLIGTVYPDS 321
            ...||.::.|..    ||.:.|.|.|.:|
 Frog   390 YGLTIQTYVWTKTTYDNGKKFIATAYAES 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoUNP_650508.1 XendoU 55..319 CDD:286496 84/285 (29%)
endouXP_002935698.3 Somatomedin_B 29..65 CDD:395820
Somatomedin_B 82..120 CDD:395820
XendoU 150..415 CDD:401387 84/284 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 1 1.000 - - otm49245
Panther 1 1.100 - - O PTHR12439
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.