DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and Ngb

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_203523.2 Gene:Ngb / 85382 RGDID:621461 Length:151 Species:Rattus norvegicus


Alignment Length:147 Identity:32/147 - (21%)
Similarity:63/147 - (42%) Gaps:12/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPL---EELSGNARFRAHAGRII 66
            |.:||:::|.....:|.:.|..:.::.|...||.|..|.:.....   |:...:..|..|..:::
  Rat     5 ESELIRQSWRAVSRSPLEHGTVLFSRLFALEPSLLPLFQYNGRQFSSPEDCLSSPEFLDHIRKVM 69

  Fly    67 RVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAACSLDESQA--A 129
            .|.|.::..:   .||..|:|....:...|....|...|::.:...:|.:|......|.:.|  .
  Rat    70 LVIDAAVTNV---EDLSSLEEYLATLGRKHRAVGVRLSSFSTVGESLLYMLEKCLGPDFTPATRT 131

  Fly   130 TWAKLVDHVYGIIFKAI 146
            .|::|    ||.:.:|:
  Rat   132 AWSQL----YGAVVQAM 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 29/137 (21%)
NgbNP_203523.2 Globin 1..149 32/147 (22%)
Ngb 1..148 CDD:271272 32/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001809
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46458
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.