DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and YHB1

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_011750.1 Gene:YHB1 / 853149 SGDID:S000003466 Length:399 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:14/73 - (19%)
Similarity:29/73 - (39%) Gaps:13/73 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LEELSGNARFRAHAGRIIRVFDESIQVLGQ-----------DGDLEKLDEIWTKI--AVSHIPRT 100
            |..|..:.:...|..|.:::..|...::|:           |....::...|.:.  |::.|..|
Yeast    71 LSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATPEIINAWGEAYQAIADIFIT 135

  Fly   101 VSKESYNQ 108
            |.|:.|.:
Yeast   136 VEKKMYEE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 14/73 (19%)
YHB1NP_011750.1 PRK13289 1..392 CDD:237337 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001809
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.