powered by:
Protein Alignment glob1 and YHB1
DIOPT Version :9
Sequence 1: | NP_001287343.1 |
Gene: | glob1 / 41930 |
FlyBaseID: | FBgn0027657 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011750.1 |
Gene: | YHB1 / 853149 |
SGDID: | S000003466 |
Length: | 399 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 73 |
Identity: | 14/73 - (19%) |
Similarity: | 29/73 - (39%) |
Gaps: | 13/73 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 LEELSGNARFRAHAGRIIRVFDESIQVLGQ-----------DGDLEKLDEIWTKI--AVSHIPRT 100
|..|..:.:...|..|.:::..|...::|: |....::...|.:. |::.|..|
Yeast 71 LSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATPEIINAWGEAYQAIADIFIT 135
Fly 101 VSKESYNQ 108
|.|:.|.:
Yeast 136 VEKKMYEE 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3378 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001809 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.