DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and HB2

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_187663.1 Gene:HB2 / 820216 AraportID:AT3G10520 Length:158 Species:Arabidopsis thaliana


Alignment Length:137 Identity:30/137 - (21%)
Similarity:54/137 - (39%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPF-RD---VPLEELSGNARFRAHAGRIIRV 68
            |:|::|||.............:|.....|:....|.| ||   ||    ..|.:.:|||.::.::
plant    13 LVKESWEILKQDIPKYSLHFFSQILEIAPAAKGLFSFLRDSDEVP----HNNPKLKAHAVKVFKM 73

  Fly    69 FDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAAC--SLDESQAATW 131
            ..|:...|.::|.:...|.....:...|:...|....:..:|..:|..|....  ..:|.....|
plant    74 TCETAIQLREEGKVVVADTTLQYLGSIHLKSGVIDPHFEVVKEALLRTLKEGLGEKYNEEVEGAW 138

  Fly   132 AKLVDHV 138
            ::..||:
plant   139 SQAYDHL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 29/136 (21%)
HB2NP_187663.1 class1-2_nsHbs_Lbs 6..152 CDD:381261 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 1 1.000 - - FOG0001809
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.