DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and glb-34

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001129874.1 Gene:glb-34 / 7040145 WormBaseID:WBGene00077763 Length:199 Species:Caenorhabditis elegans


Alignment Length:131 Identity:33/131 - (25%)
Similarity:53/131 - (40%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGAAILTQFFNRFPSNLEKFP-FRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLD 86
            :|..:..::|:.||.....:| ||.:....|..:.....|....:....|.::|:   .|.|||.
 Worm    67 NGLVLFAKYFSEFPHYKNIWPQFRTLQDSALLASNELANHCSVYMSGLKEIVEVM---DDEEKLT 128

  Fly    87 EIWTKIAVSHIPRTVSK-ESYNQLKGVILDVLTAACSLDESQAATWAKLVDHVYGIIFKAIDDDG 150
            ....:||.||:...::| ...|.|:||  ||:.        |.:...||.|.:........|..|
 Worm   129 YFMARIARSHVKWNINKYHITNMLEGV--DVVL--------QRSFGDKLTDEIVNAYHTLYDVIG 183

  Fly   151 N 151
            |
 Worm   184 N 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 30/120 (25%)
glb-34NP_001129874.1 Mb-like 55..186 CDD:381254 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106718
Panther 1 1.100 - - O PTHR46458
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.